Lineage for d1qe6b_ (1qe6 B:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 77416Fold d.9: IL8-like [54116] (2 superfamilies)
  4. 77417Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
  5. 77418Family d.9.1.1: Interleukin 8-like chemokines [54118] (20 proteins)
  6. 77451Protein Interleukin-8, IL-8 [54119] (1 species)
  7. 77452Species Human (Homo sapiens) [TaxId:9606] [54120] (9 PDB entries)
  8. 77457Domain d1qe6b_: 1qe6 B: [37360]

Details for d1qe6b_

PDB Entry: 1qe6 (more details), 2.35 Å

PDB Description: interleukin-8 with an added disulfide between residues 5 and 33 (l5c/h33c)

SCOP Domain Sequences for d1qe6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qe6b_ d.9.1.1 (B:) Interleukin-8, IL-8 {Human (Homo sapiens)}
akecrcqciktyskpfhpkfikelrviesgpccanteiivklsdgrelcldpkenwvqrv
vekflkraens

SCOP Domain Coordinates for d1qe6b_:

Click to download the PDB-style file with coordinates for d1qe6b_.
(The format of our PDB-style files is described here.)

Timeline for d1qe6b_: