Lineage for d1ef2c_ (1ef2 C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1890759Fold d.8: Urease, gamma-subunit [54110] (1 superfamily)
    alpha(3)-beta(2); antiparallel hairpin
  4. 1890760Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) (S)
  5. 1890761Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins)
    automatically mapped to Pfam PF00547
  6. 1890762Protein Urease, gamma-subunit [54113] (4 species)
  7. 1890781Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries)
  8. 1890806Domain d1ef2c_: 1ef2 C: [37348]
    Other proteins in same PDB: d1ef2a1, d1ef2a2, d1ef2b_
    complexed with mn

Details for d1ef2c_

PDB Entry: 1ef2 (more details), 2.5 Å

PDB Description: crystal structure of manganese-substituted klebsiella aerogenes urease
PDB Compounds: (C:) urease gamma subunit

SCOPe Domain Sequences for d1ef2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef2c_ d.8.1.1 (C:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]}
meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii

SCOPe Domain Coordinates for d1ef2c_:

Click to download the PDB-style file with coordinates for d1ef2c_.
(The format of our PDB-style files is described here.)

Timeline for d1ef2c_: