SCOPe 2.08: Domain d6aj8a_: 6aj8 A:

Lineage for d6aj8a_ (6aj8 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (22 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:5702] [373328] (3 PDB entries)

8. Domain d6aj8a_: 6aj8 A: [373382]
   automated match to d1t0la_
   complexed with akg, ca, nap

Details for d6aj8a_

PDB Entry: 6aj8, 2.4 Å

PDB Description: crystal structure of trypanosoma brucei glycosomal isocitrate dehydrogenase in complex with nadp+, alpha-ketoglutarate and ca2+

PDB Compounds: (A:) Isocitrate dehydrogenase [NADP]

SCOPe Domain Sequences for d6aj8a_:

Sequence; same for both SEQRES and ATOM records:

>d6aj8a_ c.77.1.1 (A:) automated matches {Trypanosoma brucei [TaxId: 5702]}
snkisatgvlveldgdemtrviwkkiketlifpfvnvpieyydlsmenrdktedrvtvea
ayaikkhgvgvkcatitpdearvkefnlkkmwrspngtirtilggtvfrepiicsnvprl
vttwkkpvvigrhafgdqysatdavvkepgtfemrfipanggepkvykvfdyksggvmmg
myntddsirdfarscfefalarkwplylstkntilkhydgrfkdifaemykalyetkfkt
cgifyehrliddmvahcmrseggyvwacknydgdvqsdslaqgfgslgmmtsilmtpdgk
tveveaahgtvtrhyrdyqkgketstnpvasifawtralahrarvdnnntlleftqrled
viiatieagamtedlaicikgeknvvradylntdefidavsqrlkvamqkskv

Timeline for d6aj8a_:

• d6aj8a_ first appeared in SCOPe 2.07