![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.8: Urease, gamma-subunit [54110] (1 superfamily) alpha(3)-beta(2); antiparallel hairpin |
![]() | Superfamily d.8.1: Urease, gamma-subunit [54111] (2 families) ![]() |
![]() | Family d.8.1.1: Urease, gamma-subunit [54112] (2 proteins) automatically mapped to Pfam PF00547 |
![]() | Protein Urease, gamma-subunit [54113] (4 species) |
![]() | Species Klebsiella aerogenes [TaxId:28451] [54114] (27 PDB entries) |
![]() | Domain d1ejta_: 1ejt A: [37328] Other proteins in same PDB: d1ejtb_, d1ejtc1, d1ejtc2 complexed with ni |
PDB Entry: 1ejt (more details), 2 Å
SCOPe Domain Sequences for d1ejta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ejta_ d.8.1.1 (A:) Urease, gamma-subunit {Klebsiella aerogenes [TaxId: 28451]} meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii
Timeline for d1ejta_: