SCOPe 2.07: Domain d6ojpa1: 6ojp A:6-185

Lineage for d6ojpa1 (6ojp A:6-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d6ojpa1: 6ojp A:6-185 [373196]
   Other proteins in same PDB: d6ojpa2, d6ojpa3, d6ojpb_
   automated match to d1zt4c2
   complexed with 7lp, bma, fuc, gol, man, nag, plm, so4

Details for d6ojpa1

PDB Entry: 6ojp, 2.17 Å

PDB Description: structure of glycolipid alpha-gsa[8,6p] in complex with mouse cd1d

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6ojpa1:

Sequence, based on SEQRES records:

>d6ojpa1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvhrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Sequence, based on observed residues (ATOM records):

>d6ojpa1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvhrvsftrdiqelvdypieiqlsagcemypgnasesflhvafqgkyvvrfwgts
wqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d6ojpa1:

• d6ojpa1 is new in SCOPe 2.07-stable
  
• d6ojpa1 appears in the current release, SCOPe 2.08