Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein automated matches [190306] (9 species) not a true protein |
Species Staphylococcus epidermidis [TaxId:176280] [227720] (6 PDB entries) |
Domain d6pyma_: 6pym A: [373014] automated match to d4jcna_ mutant |
PDB Entry: 6pym (more details), 1.2 Å
SCOPe Domain Sequences for d6pyma_:
Sequence, based on SEQRES records: (download)
>d6pyma_ b.47.1.1 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]} vilpnnnrhqifnttqghydavsfiyipidggymsgsgvvvgeneiltnkhvvngakgnp rnisvhpsaknendypngkfvgqeiipypgnsdlailrvspnehnqhigqvvkpatissn tdtrinenitvtgypgdkplatmwesvgkvvyiggeelrydlstvggnagspvfngknqv igihyggvdnkynssvyindfvqqflrnnipdiniq
>d6pyma_ b.47.1.1 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]} vilpnnnrhqifnttqghydavsfiyipgymsgsgvvvgeneiltnkhvvngakgnprni svhpsaknendypngkfvgqeiipypgnsdlailrvspnehnqhigqvvkpatissntdt rinenitvtgypgdkplatmwesvgkvvyiggeelrydlstvggnagspvfngknqvigi hyggvdnkynssvyindfvqqflrnnipdiniq
Timeline for d6pyma_: