Lineage for d11baa_ (11ba A:)
- Root: SCOP 1.65
Class d: Alpha and beta proteins (a+b) [53931] (234 folds) Fold d.5: RNase A-like [54075] (1 superfamily)
contains long curved beta-sheet and 3 helicesSuperfamily d.5.1: RNase A-like [54076] (1 family) 
can be classified as disulphide-richFamily d.5.1.1: Ribonuclease A-like [54077] (8 proteins) 
Protein Seminal ribonucleasease [54086] (1 species) Species Cow (Bos taurus) [TaxId:9913] [54087] (4 PDB entries) 
Domain d11baa_: 11ba A: [37284]
Details for d11baa_
PDB Entry: 11ba (more details), 2.06 Å
PDB Description: binding of a substrate analogue to a domain swapping protein in the complex of bovine seminal ribonuclease with uridylyl-2',5'-adenosine
SCOP Domain Sequences for d11baa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d11baa_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus)}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv
SCOP Domain Coordinates for d11baa_:
Click to download the PDB-style file with coordinates for d11baa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d11baa_:
- d11baa_ first appeared (with stable ids) in SCOP 1.55
- d11baa_ appears in SCOP 1.63
- d11baa_ appears in SCOP 1.67
- d11baa_ appears in the current release, SCOPe 2.08
View in 3D
