SCOPe 2.08: Domain d11baa_: 11ba A:

Lineage for d11baa_ (11ba A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Seminal ribonucleasease [54086] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54087] (17 PDB entries)
   Uniprot P00669 27-150

8. Domain d11baa_: 11ba A: [37284]
   protein/RNA complex; complexed with so4, upa

Details for d11baa_

PDB Entry: 11ba, 2.06 Å

PDB Description: binding of a substrate analogue to a domain swapping protein in the complex of bovine seminal ribonuclease with uridylyl-2',5'-adenosine

PDB Compounds: (A:) protein (ribonuclease, seminal)

SCOPe Domain Sequences for d11baa_:

Sequence; same for both SEQRES and ATOM records:

>d11baa_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus) [TaxId: 9913]}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

Timeline for d11baa_:

• d11baa_ first appeared (with stable ids) in SCOP 1.55
  
• d11baa_ appears in SCOPe 2.07