Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (309 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:196627] [315006] (3 PDB entries) |
Domain d6jx2a1: 6jx2 A:3-184 [372521] Other proteins in same PDB: d6jx2a2, d6jx2b2, d6jx2c2, d6jx2d2 automated match to d4xiya1 complexed with edo, mg, nap |
PDB Entry: 6jx2 (more details), 2.6 Å
SCOPe Domain Sequences for d6jx2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6jx2a1 c.2.1.0 (A:3-184) automated matches {Corynebacterium glutamicum [TaxId: 196627]} iellydadadlsliqgrkvaivgygsqghahsqnlrdsgvevviglregsksaekakeag fevkttaeaaawadvimllapdtsqaeiftndiepnlnagdallfghglnihfdlikpad diivgmvapkgpghlvrrqfvdgkgvpcliavdqdptgtaqaltlsyaaaiggaragvip tt
Timeline for d6jx2a1: