SCOPe 2.07: Domain d6jx2b2: 6jx2 B:185-329

Lineage for d6jx2b2 (6jx2 B:185-329)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:196627] [372515] (1 PDB entry)

8. Domain d6jx2b2: 6jx2 B:185-329 [372517]
   Other proteins in same PDB: d6jx2a1, d6jx2b1, d6jx2c1, d6jx2d1
   automated match to d4xiya2
   complexed with edo, mg, nap

Details for d6jx2b2

PDB Entry: 6jx2, 2.6 Å

PDB Description: crystal structure of ketol-acid reductoisomerase from corynebacterium glutamicum

PDB Compounds: (B:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6jx2b2:

Sequence; same for both SEQRES and ATOM records:

>d6jx2b2 a.100.1.0 (B:185-329) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
feaetvtdlfgeqavlcggteelvkvgfevlteagyepemayfevlhelklivdlmfegg
isnmnysvsdtaefggylsgprvidadtksrmkdiltdiqdgtftkrlianvengntele
glrasynnhpieetgaklrdlmswv

Timeline for d6jx2b2:

• d6jx2b2 is new in SCOPe 2.07-stable
  
• d6jx2b2 appears in the current release, SCOPe 2.08