Lineage for d1afub_ (1afu B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928145Protein Ribonuclease A (also ribonuclease B, S) [54078] (4 species)
  7. 2928150Species Cow (Bos taurus) [TaxId:9913] [54079] (212 PDB entries)
  8. 2928288Domain d1afub_: 1afu B: [37245]

Details for d1afub_

PDB Entry: 1afu (more details), 2 Å

PDB Description: structure of ribonuclease a at 2.0 angstroms from monoclinic crystals
PDB Compounds: (B:) ribonuclease a

SCOPe Domain Sequences for d1afub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1afub_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d1afub_:

Click to download the PDB-style file with coordinates for d1afub_.
(The format of our PDB-style files is described here.)

Timeline for d1afub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1afua_