SCOPe 2.08: Domain d5zy9e2: 5zy9 E:294-400

Lineage for d5zy9e2 (5zy9 E:294-400)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.0: automated matches [227929] (1 protein)
   not a true family

6. Protein automated matches [227930] (6 species)
   not a true protein

7. Species Phytophthora sojae [TaxId:67593] [371713] (1 PDB entry)

8. Domain d5zy9e2: 5zy9 E:294-400 [371714]
   Other proteins in same PDB: d5zy9c1, d5zy9d1, d5zy9e1
   automated match to d4p3na2
   complexed with 2cr, zn

Details for d5zy9e2

PDB Entry: 5zy9, 2.5 Å

PDB Description: structural basis for a trna synthetase

PDB Compounds: (E:) Threonyl-tRNA synthase

SCOPe Domain Sequences for d5zy9e2:

Sequence; same for both SEQRES and ATOM records:

>d5zy9e2 c.51.1.0 (E:294-400) automated matches {Phytophthora sojae [TaxId: 67593]}
fpfwlsprqvlivtvgaafvdygyevkdamfragfdvdiddtgktlnkkiregqmahynf
ilvvgaheketrsvnirtrdnkvtgtktleeaiamfkeleetkaade

Timeline for d5zy9e2:

• d5zy9e2 first appeared in SCOPe 2.07