SCOPe 2.07: Domain d6q5uf1: 6q5u F:2-244

Lineage for d6q5uf1 (6q5u F:2-244)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families)
   duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
   trimeric; in the trimers, the domains are arranged around pseudo six-fold axis

5. Family b.121.2.1: Coat protein p3 [49750] (2 proteins)

6. Protein automated matches [371282] (1 species)
   not a true protein

7. Species Enterobacteria phage [TaxId:261665] [371283] (1 PDB entry)

8. Domain d6q5uf1: 6q5u F:2-244 [371535]
   Other proteins in same PDB: d6q5ua2, d6q5ub2, d6q5uc2, d6q5ud2, d6q5ue2, d6q5uf2, d6q5ug2, d6q5uh2, d6q5ui2, d6q5uj2, d6q5uk2, d6q5ul2
   automated match to d1cjdb1

Details for d6q5uf1

PDB Entry: 6q5u, 2.75 Å

PDB Description: high resolution electron cryo-microscopy structure of the bacteriophage pr772

PDB Compounds: (F:) Major Capsid Protein (P3)

SCOPe Domain Sequences for d6q5uf1:

Sequence; same for both SEQRES and ATOM records:

>d6q5uf1 b.121.2.1 (F:2-244) automated matches {Enterobacteria phage [TaxId: 261665]}
aqvqqltpaqqaalrnqqamaanlqarqivlqqsypviqqvetqtfdpanrsvfdvtpan
vgivkgflvkvtaaiknnhateavaltdfgpanlvqrviyydpdnqrhtetsgwhlhfvn
takqgapflssmvtdspikygdvmnvidapatiaagatgeltmyywvplaysetdltgav
lanvpqskqrlklefannntafaavganpleaiyqgagaadcefeeisytvyqsyldqlp
vgq

Timeline for d6q5uf1:

• d6q5uf1 is new in SCOPe 2.07-stable
  
• d6q5uf1 appears in the current release, SCOPe 2.08