Lineage for d6q5uh2 (6q5u H:245-384)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2430859Superfamily b.121.2: Group II dsDNA viruses VP [49749] (4 families) (S)
    duplication: consists of two domains of this fold packed together like the nucleoplasmin subunits
    trimeric; in the trimers, the domains are arranged around pseudo six-fold axis
  5. 2430949Family b.121.2.0: automated matches [227210] (1 protein)
    not a true family
  6. 2430950Protein automated matches [226945] (4 species)
    not a true protein
  7. 2430951Species Enterobacteria phage [TaxId:261665] [371285] (1 PDB entry)
  8. 2430959Domain d6q5uh2: 6q5u H:245-384 [371435]
    Other proteins in same PDB: d6q5ua1, d6q5ub1, d6q5uc1, d6q5ud1, d6q5ue1, d6q5uf1, d6q5ug1, d6q5uh1, d6q5ui1, d6q5uj1, d6q5uk1, d6q5ul1
    automated match to d1hx6a2

Details for d6q5uh2

PDB Entry: 6q5u (more details), 2.75 Å

PDB Description: high resolution electron cryo-microscopy structure of the bacteriophage pr772
PDB Compounds: (H:) Major Capsid Protein (P3)

SCOPe Domain Sequences for d6q5uh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6q5uh2 b.121.2.0 (H:245-384) automated matches {Enterobacteria phage [TaxId: 261665]}
ngyilplidlstlynlensaqagltpnvdfvvqyanlyrylstiavfdnggsfnagtdin
ylsqrtanfsdtrkldpktwaaqtrrriatdfpkgvyycdnrdkpiytlqygnvgfvvnp
ktvnqnarllmgyeyftsrt

SCOPe Domain Coordinates for d6q5uh2:

Click to download the PDB-style file with coordinates for d6q5uh2.
(The format of our PDB-style files is described here.)

Timeline for d6q5uh2: