Lineage for d1e2th_ (1e2t H:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1192270Family d.3.1.5: Arylamine N-acetyltransferase [54047] (2 proteins)
    fold similar to that of the factor XIII catalytic domain
  6. 1192271Protein Arylamine N-acetyltransferase [54048] (4 species)
  7. 1192286Species Salmonella typhimurium [TaxId:90371] [54049] (1 PDB entry)
  8. 1192294Domain d1e2th_: 1e2t H: [37128]

Details for d1e2th_

PDB Entry: 1e2t (more details), 2.8 Å

PDB Description: arylamine n-acetyltransferase (nat) from salmonella typhimurium
PDB Compounds: (H:) n-hydroxyarylamine o-acetyltransferase

SCOPe Domain Sequences for d1e2th_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e2th_ d.3.1.5 (H:) Arylamine N-acetyltransferase {Salmonella typhimurium [TaxId: 90371]}
hmtsflhayftrlhcqplgvptvealrtlhlahncaipfenldvllpreiqldetaleek
llyarrggycfelnglferalrdigfnvrsllgrvilshpaslpprthrlllvdvedeqw
iadvgfggqtltaplrlqaeiaqqtphgeyrlmqegstwilqfrhhehwqsmycfdlgvq
qqsdhvmgnfwsahwpqshfrhhllmcrhlpdggkltltnfhftryhqghaveqvnvpdv
pslyqllqqqfglgvndvkhgfteaelaavmaaf

SCOPe Domain Coordinates for d1e2th_:

Click to download the PDB-style file with coordinates for d1e2th_.
(The format of our PDB-style files is described here.)

Timeline for d1e2th_: