Lineage for d6n80f_ (6n80 F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460794Protein automated matches [190149] (15 species)
    not a true protein
  7. 2461182Species Staphylococcus aureus [TaxId:93061] [189958] (9 PDB entries)
  8. 2461229Domain d6n80f_: 6n80 F: [370726]
    automated match to d3qwda_
    complexed with jt7

Details for d6n80f_

PDB Entry: 6n80 (more details), 1.96 Å

PDB Description: s. aureus clpp bound to anti-4a
PDB Compounds: (F:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d6n80f_:

Sequence, based on SEQRES records: (download)

>d6n80f_ c.14.1.1 (F:) automated matches {Staphylococcus aureus [TaxId: 93061]}
iptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyly
inspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmih
qplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakey
glidevmvp

Sequence, based on observed residues (ATOM records): (download)

>d6n80f_ c.14.1.1 (F:) automated matches {Staphylococcus aureus [TaxId: 93061]}
iptvydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspggsvta
gfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqa
teieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp

SCOPe Domain Coordinates for d6n80f_:

Click to download the PDB-style file with coordinates for d6n80f_.
(The format of our PDB-style files is described here.)

Timeline for d6n80f_: