SCOPe 2.06: Domain d1theb_: 1the B:

Lineage for d1theb_ (1the B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein (Pro)cathepsin B [54022] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [54024] (4 PDB entries)

8. Domain d1theb_: 1the B: [37057]
   complexed with 0e6

Details for d1theb_

PDB Entry: 1the, 1.9 Å

PDB Description: crystal structures of recombinant rat cathepsin b and a cathepsin b-inhibitor complex: implications for structure-based inhibitor design

PDB Compounds: (B:) cathepsin b

SCOPe Domain Sequences for d1theb_:

Sequence; same for both SEQRES and ATOM records:

>d1theb_ d.3.1.1 (B:) (Pro)cathepsin B {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lpesfdareqwsncptiaqirdqgscgscwafgaveamsdricihtngrvnvevsaedll
tccgiqcgdgcnggypsgawnfwtrkglvsggvynshigclpytippcehhvngarppct
gegdtpkcnkmceagystsykedkhygytsysvsdsekeimaeiykngpvegaftvfsdf
ltyksgvykheagdvmgghairilgwgiengvpywlvanswnadwgdngffkilrgenhc
gieseivagiprt

Timeline for d1theb_:

• d1theb_ first appeared (with stable ids) in SCOP 1.55
  
• d1theb_ appears in SCOPe 2.05
  
• d1theb_ appears in SCOPe 2.07
  
• d1theb_ appears in the current release, SCOPe 2.08