SCOPe 2.08: Domain d6jida2: 6jid A:157-333

Lineage for d6jida2 (6jid A:157-333)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186944] (65 PDB entries)

8. Domain d6jida2: 6jid A:157-333 [370415]
   Other proteins in same PDB: d6jida1, d6jidb1
   automated match to d5tc4a2
   complexed with bqc, gol, po4

Details for d6jida2

PDB Entry: 6jid, 2.5 Å

PDB Description: human mthfd2 in complex with compound 1

PDB Compounds: (A:) Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial

SCOPe Domain Sequences for d6jida2:

Sequence, based on SEQRES records:

>d6jida2 c.2.1.0 (A:157-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllhtd
gaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidvgi
nrvhdpvtakpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvlr

Sequence, based on observed residues (ATOM records):

>d6jida2 c.2.1.0 (A:157-333) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhvinvgrmcldqysmlpatpwgvweiikrtgiptlgknvvvagrsknvgmpiamllhtd
gaherpggdatvtishrytpkeqlkkhtiladivisaagipnlitadmikegaavidvgi
nrvhdkpklvgdvdfegvrqkagyitpvpggvgpmtvamlmkntiiaakkvlr

Timeline for d6jida2:

• d6jida2 first appeared in SCOPe 2.07