Lineage for d6gkda_ (6gkd A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478252Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2478268Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species)
  7. 2478269Species Human (Homo sapiens) [TaxId:9606] [117543] (26 PDB entries)
    Uniprot P13569 389-671
  8. 2478308Domain d6gkda_: 6gkd A: [369975]
    Other proteins in same PDB: d6gkdb1, d6gkdb2, d6gkdc1, d6gkdc2, d6gkdg1, d6gkdg2, d6gkdh1, d6gkdh2, d6gkdj1, d6gkdj2, d6gkdk1, d6gkdk2, d6gkdm1, d6gkdm2, d6gkdn1, d6gkdn2, d6gkdp1, d6gkdp2, d6gkdq1, d6gkdq2, d6gkds1, d6gkds2, d6gkdt1, d6gkdt2
    automated match to d2pzga_
    complexed with atp, gol, mg, swe

Details for d6gkda_

PDB Entry: 6gkd (more details), 2.99 Å

PDB Description: human nbd1 of cftr in complex with nanobodies d12 and g3a
PDB Compounds: (A:) Cystic fibrosis transmembrane conductance regulator

SCOPe Domain Sequences for d6gkda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gkda_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ttevvmenvtafweeggtpvlkdinfkiergqllavagstgagktsllmmimgelepseg
kikhsgrisfcsqfswimpgtikeniifgvsydeyryrsvikacqleediskfaekdniv
lgeggitlsggqrarislaravykdadlylldspfgyldvltekeifescvcklmanktr
ilvtskmehlkkadkililhegssyfygtfselqnl

SCOPe Domain Coordinates for d6gkda_:

Click to download the PDB-style file with coordinates for d6gkda_.
(The format of our PDB-style files is described here.)

Timeline for d6gkda_: