Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries) |
Domain d6gkdj1: 6gkd J:6-123 [369954] Other proteins in same PDB: d6gkda_, d6gkdb2, d6gkdc2, d6gkdf_, d6gkdg2, d6gkdh2, d6gkdi_, d6gkdj2, d6gkdk2, d6gkdl_, d6gkdm2, d6gkdn2, d6gkdo_, d6gkdp2, d6gkdq2, d6gkdr_, d6gkds2, d6gkdt2 automated match to d4nbzb_ complexed with atp, gol, mg, swe |
PDB Entry: 6gkd (more details), 2.99 Å
SCOPe Domain Sequences for d6gkdj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gkdj1 b.1.1.0 (J:6-123) automated matches {Llama (Lama glama) [TaxId: 9844]} esggglvqagsslrlacaatgsirsinnmgwyrqapgkqrgmvaiitrvgntdyadsvkg rftisrdnakntvylqmnslkpedtatyychaeiteqsrpfyltddywgqgtqvtvss
Timeline for d6gkdj1:
View in 3D Domains from other chains: (mouse over for more information) d6gkda_, d6gkdb1, d6gkdb2, d6gkdc1, d6gkdc2, d6gkdf_, d6gkdg1, d6gkdg2, d6gkdh1, d6gkdh2, d6gkdi_, d6gkdk1, d6gkdk2, d6gkdl_, d6gkdm1, d6gkdm2, d6gkdn1, d6gkdn2, d6gkdo_, d6gkdp1, d6gkdp2, d6gkdq1, d6gkdq2, d6gkdr_, d6gkds1, d6gkds2, d6gkdt1, d6gkdt2 |