Lineage for d6gkdj1 (6gkd J:6-123)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369702Species Llama (Lama glama) [TaxId:9844] [189241] (37 PDB entries)
  8. 2369764Domain d6gkdj1: 6gkd J:6-123 [369954]
    Other proteins in same PDB: d6gkda_, d6gkdb2, d6gkdc2, d6gkdf_, d6gkdg2, d6gkdh2, d6gkdi_, d6gkdj2, d6gkdk2, d6gkdl_, d6gkdm2, d6gkdn2, d6gkdo_, d6gkdp2, d6gkdq2, d6gkdr_, d6gkds2, d6gkdt2
    automated match to d4nbzb_
    complexed with atp, gol, mg, swe

Details for d6gkdj1

PDB Entry: 6gkd (more details), 2.99 Å

PDB Description: human nbd1 of cftr in complex with nanobodies d12 and g3a
PDB Compounds: (J:) Nanobody D12

SCOPe Domain Sequences for d6gkdj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gkdj1 b.1.1.0 (J:6-123) automated matches {Llama (Lama glama) [TaxId: 9844]}
esggglvqagsslrlacaatgsirsinnmgwyrqapgkqrgmvaiitrvgntdyadsvkg
rftisrdnakntvylqmnslkpedtatyychaeiteqsrpfyltddywgqgtqvtvss

SCOPe Domain Coordinates for d6gkdj1:

Click to download the PDB-style file with coordinates for d6gkdj1.
(The format of our PDB-style files is described here.)

Timeline for d6gkdj1:

2369764
d6gkdj1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d6gkdj2