Lineage for d6go4a2 (6go4 A:243-302)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328564Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2329531Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2329809Family a.60.12.0: automated matches [254215] (1 protein)
    not a true family
  6. 2329810Protein automated matches [254483] (3 species)
    not a true protein
  7. 2329829Species Mouse (Mus musculus) [TaxId:10090] [255237] (31 PDB entries)
  8. 2329831Domain d6go4a2: 6go4 A:243-302 [369895]
    Other proteins in same PDB: d6go4a1, d6go4a3
    automated match to d1jmsa3
    protein/DNA complex; complexed with dct, mg, na

Details for d6go4a2

PDB Entry: 6go4 (more details), 1.96 Å

PDB Description: tdt chimera (loop1 of pol mu) - binary complex with ddctp
PDB Compounds: (A:) DNA nucleotidylexotransferase,DNA-directed DNA/RNA polymerase mu,DNA nucleotidylexotransferase

SCOPe Domain Sequences for d6go4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6go4a2 a.60.12.0 (A:243-302) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
deryksfklftsvfgvglktaekwfrmgfrtlskiqsdkslrftqmqkagflyyedlvsc

SCOPe Domain Coordinates for d6go4a2:

Click to download the PDB-style file with coordinates for d6go4a2.
(The format of our PDB-style files is described here.)

Timeline for d6go4a2: