Lineage for d6efub_ (6efu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833262Species Trichoderma harzianum [TaxId:5544] [319250] (6 PDB entries)
  8. 2833265Domain d6efub_: 6efu B: [369815]
    Other proteins in same PDB: d6efua2
    automated match to d5jbka_
    complexed with no3; mutant

Details for d6efub_

PDB Entry: 6efu (more details), 2.2 Å

PDB Description: crystal structure of the double mutant l167w / p172l of the beta- glucosidase from trichoderma harzianum
PDB Compounds: (B:) Beta-glucosidase

SCOPe Domain Sequences for d6efub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6efub_ c.1.8.0 (B:) automated matches {Trichoderma harzianum [TaxId: 5544]}
mlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtaed
iallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfhw
dlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfnepwcsailgygsgtfa
pgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldre
aaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhytsn
yirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskrynyp
kiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslmd
nfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliak

SCOPe Domain Coordinates for d6efub_:

Click to download the PDB-style file with coordinates for d6efub_.
(The format of our PDB-style files is described here.)

Timeline for d6efub_: