Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (132 species) not a true protein |
Species Trichoderma harzianum [TaxId:5544] [319250] (6 PDB entries) |
Domain d6efub_: 6efu B: [369815] Other proteins in same PDB: d6efua2 automated match to d5jbka_ complexed with no3; mutant |
PDB Entry: 6efu (more details), 2.2 Å
SCOPe Domain Sequences for d6efub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6efub_ c.1.8.0 (B:) automated matches {Trichoderma harzianum [TaxId: 5544]} mlpkdfqwgfataayqiegaidkdgrgpsiwdtfcaipgkiadgtsgvtacdsynrtaed iallkslgaksyrfsiswsriipkggrddpvnqlgidhyaqfvddlleagitpfitlfhw dlpeelhqryggllnrtefpldfenyarvmfkalpkvrnwitfnepwcsailgygsgtfa pgrqsttepwivghnllvahgravkvyrdefkdlndgqigivlngdftypwdssdpldre aaerrlefftawyadpiylgdypasmrkqlgdrlpeftpeekafvlgsndfygmnhytsn yirhrtspataddtvgnvdvlfynkegqcigpetesswlrpcpagfrdflvwiskrynyp kiyvtengtslkgendlpkekileddfrvnyyneyiramftaatldgvnvkgyfawslmd nfewadgyvtrfgvtyvdyengqqrfpkksakslkplfdeliak
Timeline for d6efub_: