Lineage for d6dqha_ (6dqh A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603545Species Cronobacter sakazakii [TaxId:28141] [369718] (5 PDB entries)
  8. 2603546Domain d6dqha_: 6dqh A: [369739]
    automated match to d3lvzb_
    complexed with po4, zn

Details for d6dqha_

PDB Entry: 6dqh (more details), 1.1 Å

PDB Description: cronobacter sakazakii (enterobacter sakazakii) metallo-beta-lactamse harldq motif
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d6dqha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dqha_ d.157.1.0 (A:) automated matches {Cronobacter sakazakii [TaxId: 28141]}
vqpfaiwpgvwyvgtenlssvllttpqghilidagldasapqirrniealgfrmadiryi
anshahldqaggiarlkawsgarviashanaeqmarggkedfalgdalpfppvtvdmeaq
dgqqwhlggvtlaaiftpghlpgatswkvtladgktliyadslatpgyplinnrnyptlv
edirrsfarleaqqvdiflankgerfglmdkmarkargennafidkaglaryvaqsraaf
ekqlaaqraq

SCOPe Domain Coordinates for d6dqha_:

Click to download the PDB-style file with coordinates for d6dqha_.
(The format of our PDB-style files is described here.)

Timeline for d6dqha_: