Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (31 species) not a true protein |
Species Cronobacter sakazakii [TaxId:28141] [369718] (5 PDB entries) |
Domain d6dqha_: 6dqh A: [369739] automated match to d3lvzb_ complexed with po4, zn |
PDB Entry: 6dqh (more details), 1.1 Å
SCOPe Domain Sequences for d6dqha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dqha_ d.157.1.0 (A:) automated matches {Cronobacter sakazakii [TaxId: 28141]} vqpfaiwpgvwyvgtenlssvllttpqghilidagldasapqirrniealgfrmadiryi anshahldqaggiarlkawsgarviashanaeqmarggkedfalgdalpfppvtvdmeaq dgqqwhlggvtlaaiftpghlpgatswkvtladgktliyadslatpgyplinnrnyptlv edirrsfarleaqqvdiflankgerfglmdkmarkargennafidkaglaryvaqsraaf ekqlaaqraq
Timeline for d6dqha_: