Lineage for d3lvzb_ (3lvz B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2603069Protein automated matches [190079] (12 species)
    not a true protein
  7. 2603097Species Bradyrhizobium japonicum [TaxId:224911] [226051] (4 PDB entries)
  8. 2603099Domain d3lvzb_: 3lvz B: [213076]
    automated match to d2gmna1
    complexed with zn

Details for d3lvzb_

PDB Entry: 3lvz (more details), 1.4 Å

PDB Description: New refinement of the crystal structure of BJP-1, a subclass B3 metallo-beta-lactamase of Bradyrhizobium japonicum
PDB Compounds: (B:) Blr6230 protein

SCOPe Domain Sequences for d3lvzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lvzb_ d.157.1.1 (B:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
tikdflavamkkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmik
dniaklgfkvadiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdek
nedlafpavkvdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffc
sgtvalnrlvgqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapn
pfikpgelvtyatslsedfdkqlakqtaalekk

SCOPe Domain Coordinates for d3lvzb_:

Click to download the PDB-style file with coordinates for d3lvzb_.
(The format of our PDB-style files is described here.)

Timeline for d3lvzb_: