Lineage for d6osra2 (6osr A:330-492)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2646381Family h.3.1.0: automated matches [254278] (1 protein)
    not a true family
  6. 2646382Protein automated matches [254645] (42 species)
    not a true protein
  7. 2646470Species Influenza a virus (a/melbourne/1/1946(h1n1)) [TaxId:506347] [368938] (1 PDB entry)
  8. 2646471Domain d6osra2: 6osr A:330-492 [368982]
    Other proteins in same PDB: d6osra1, d6osrb1, d6osrb3, d6osrc1, d6osrd1, d6osre1, d6osrf1
    automated match to d4wsrd2
    complexed with bma, edo, k, man, na, nag

Details for d6osra2

PDB Entry: 6osr (more details), 2.55 Å

PDB Description: crystal structure of influenza hemagglutinin from strain a/melbourne/1/1946(h1n1)
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d6osra2:

Sequence, based on SEQRES records: (download)

>d6osra2 h.3.1.0 (A:330-492) automated matches {Influenza a virus (a/melbourne/1/1946(h1n1)) [TaxId: 506347]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnnlekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye
kvkiqlknnakeigngcfefyhkcdnecmesvrngtydypkys

Sequence, based on observed residues (ATOM records): (download)

>d6osra2 h.3.1.0 (A:330-492) automated matches {Influenza a virus (a/melbourne/1/1946(h1n1)) [TaxId: 506347]}
glfgaiagfieggwtgmidgwygyhhqneqyaadqkstqnaingitnkvnsviekmntqf
tavgkefnnlekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlyekvk
iqlknnakeigngcfefyhkcdnecmesvrngtydypkys

SCOPe Domain Coordinates for d6osra2:

Click to download the PDB-style file with coordinates for d6osra2.
(The format of our PDB-style files is described here.)

Timeline for d6osra2: