SCOPe 2.07: Domain d6osrd2: 6osr D:330-491

Lineage for d6osrd2 (6osr D:330-491)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza a virus (a/melbourne/1/1946(h1n1)) [TaxId:506347] [368938] (1 PDB entry)

8. Domain d6osrd2: 6osr D:330-491 [368967]
   Other proteins in same PDB: d6osra1, d6osrb1, d6osrb3, d6osrc1, d6osrd1, d6osre1, d6osrf1
   automated match to d4wsrd2
   complexed with bma, edo, k, man, na, nag

Details for d6osrd2

PDB Entry: 6osr, 2.55 Å

PDB Description: crystal structure of influenza hemagglutinin from strain a/melbourne/1/1946(h1n1)

PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d6osrd2:

Sequence; same for both SEQRES and ATOM records:

>d6osrd2 h.3.1.0 (D:330-491) automated matches {Influenza a virus (a/melbourne/1/1946(h1n1)) [TaxId: 506347]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
tqftavgkefnnlekrmenlnkkvddgfldiwtynaellvllenertldfhdsnvknlye
kvkiqlknnakeigngcfefyhkcdnecmesvrngtydypky

Timeline for d6osrd2:

• d6osrd2 is new in SCOPe 2.07-stable
  
• d6osrd2 appears in the current release, SCOPe 2.08