Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d6cxfd2: 6cxf D:113-240 [367381] Other proteins in same PDB: d6cxfa1, d6cxfb_, d6cxfc2 automated match to d3q5ya2 complexed with bma, els, fuc, man, na, nag |
PDB Entry: 6cxf (more details), 2.5 Å
SCOPe Domain Sequences for d6cxfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6cxfd2 b.1.1.0 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d6cxfd2: