Lineage for d6cxfa1 (6cxf A:7-185)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545946Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2546009Domain d6cxfa1: 6cxf A:7-185 [367333]
    Other proteins in same PDB: d6cxfa2, d6cxfb_, d6cxfc1, d6cxfc2, d6cxfd1, d6cxfd2
    automated match to d1zt4c2
    complexed with bma, els, fuc, man, na, nag

Details for d6cxfa1

PDB Entry: 6cxf (more details), 2.5 Å

PDB Description: structure of alpha-gsa[26,p5p] bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6cxfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cxfa1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d6cxfa1:

Click to download the PDB-style file with coordinates for d6cxfa1.
(The format of our PDB-style files is described here.)

Timeline for d6cxfa1: