SCOPe 2.07: Domain d6cxec1: 6cxe C:2-115

Lineage for d6cxec1 (6cxe C:2-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d6cxec1: 6cxe C:2-115 [367353]
   Other proteins in same PDB: d6cxea1, d6cxeb_, d6cxec2
   automated match to d2pyfa1
   complexed with em4, fuc, na, nag

Details for d6cxec1

PDB Entry: 6cxe, 2.05 Å

PDB Description: structure of alpha-gsa[26,6p] bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (C:) Chimeric T cell antigen receptor alpha chain Va14,Va24,Ja18

SCOPe Domain Sequences for d6cxec1:

Sequence; same for both SEQRES and ATOM records:

>d6cxec1 b.1.1.0 (C:2-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d6cxec1:

• d6cxec1 is new in SCOPe 2.07-stable
  
• d6cxec1 appears in the current release, SCOPe 2.08