Lineage for d6cxea2 (6cxe A:186-279)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370330Domain d6cxea2: 6cxe A:186-279 [367316]
    Other proteins in same PDB: d6cxea1, d6cxeb_, d6cxec2
    automated match to d1zt4c1
    complexed with em4, fuc, na, nag

Details for d6cxea2

PDB Entry: 6cxe (more details), 2.05 Å

PDB Description: structure of alpha-gsa[26,6p] bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6cxea2:

Sequence, based on SEQRES records: (download)

>d6cxea2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d6cxea2 b.1.1.0 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqa
tldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d6cxea2:

Click to download the PDB-style file with coordinates for d6cxea2.
(The format of our PDB-style files is described here.)

Timeline for d6cxea2: