SCOPe 2.07: Domain d6j0gd1: 6j0g D:298-484

Lineage for d6j0gd1 (6j0g D:298-484)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (107 PDB entries)

8. Domain d6j0gd1: 6j0g D:298-484 [367252]
   Other proteins in same PDB: d6j0ga2, d6j0gb2, d6j0gc2, d6j0gd2
   automated match to d5lyga_
   complexed with h6p; mutant

Details for d6j0gd1

PDB Entry: 6j0g, 1.6 Å

PDB Description: crystal structure of intracellular b30.2 domain of btn3a3 mutant in complex with hmbpp

PDB Compounds: (D:) Butyrophilin subfamily 3 member A3

SCOPe Domain Sequences for d6j0gd1:

Sequence; same for both SEQRES and ATOM records:

>d6j0gd1 b.29.1.0 (D:298-484) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayhewkmalfkpadvildpdtanaillvsedqrsvqraeeprdlpdnperfewhycvlgc
enftsgrhywevevgdrkewhigvcsknverkkgwvkmtpengywtmgltdgnkyralte
prtnlklpepprkvgifldyetgeisfynatdgshiytfphasfseplypvfriltlept
alticpi

Timeline for d6j0gd1:

• d6j0gd1 is new in SCOPe 2.07-stable
  
• d6j0gd1 appears in the current release, SCOPe 2.08