Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187655] (109 PDB entries) |
Domain d6j0gd1: 6j0g D:298-484 [367252] Other proteins in same PDB: d6j0ga2, d6j0gb2, d6j0gc2, d6j0gd2 automated match to d5lyga_ complexed with h6p; mutant |
PDB Entry: 6j0g (more details), 1.6 Å
SCOPe Domain Sequences for d6j0gd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j0gd1 b.29.1.0 (D:298-484) automated matches {Human (Homo sapiens) [TaxId: 9606]} ayhewkmalfkpadvildpdtanaillvsedqrsvqraeeprdlpdnperfewhycvlgc enftsgrhywevevgdrkewhigvcsknverkkgwvkmtpengywtmgltdgnkyralte prtnlklpepprkvgifldyetgeisfynatdgshiytfphasfseplypvfriltlept alticpi
Timeline for d6j0gd1: