Lineage for d6mpxa1 (6mpx A:4-114)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608027Family d.169.1.6: Noncollagenous (NC1) domain of collagen IV [75585] (2 proteins)
    duplication: consists of two subdomains of this fold; segment swapping within and between individual domains
    automatically mapped to Pfam PF01413
  6. 2608028Protein Noncollagenous (NC1) domain of collagen IV [75586] (2 species)
  7. 2608114Species Human (Homo sapiens) [TaxId:9606] [75587] (5 PDB entries)
  8. 2608139Domain d6mpxa1: 6mpx A:4-114 [367243]
    automated match to d1li1a1
    complexed with cl, gol, p6g, peg, pge, so4

Details for d6mpxa1

PDB Entry: 6mpx (more details), 1.9 Å

PDB Description: twelve chloride ions induce formation and stabilize the nc1 hexamer of collagen iv assembled from transition state trimers
PDB Compounds: (A:) fusion protein of non-collagenous domains of collagen type IV

SCOPe Domain Sequences for d6mpxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6mpxa1 d.169.1.6 (A:4-114) Noncollagenous (NC1) domain of collagen IV {Human (Homo sapiens) [TaxId: 9606]}
hgflvtrhsqtiddpqcpsgtkilyhgysllyvqgnerahgqdlgtagsclrkfstmpfl
fcninnvcnfasrndysywlstpepmpmsmapitgenirpfisrcavceap

SCOPe Domain Coordinates for d6mpxa1:

Click to download the PDB-style file with coordinates for d6mpxa1.
(The format of our PDB-style files is described here.)

Timeline for d6mpxa1: