Lineage for d6cwea1 (6cwe A:7-185)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545946Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)
  8. 2545984Domain d6cwea1: 6cwe A:7-185 [367064]
    Other proteins in same PDB: d6cwea2, d6cweb_, d6cwec1, d6cwec2, d6cwed1, d6cwed2
    automated match to d1zt4c2
    complexed with 7lp, fuc, nag, plm

Details for d6cwea1

PDB Entry: 6cwe (more details), 2.2 Å

PDB Description: structure of alpha-gsa[8,6p] bound by cd1d and in complex with the va14vb8.2 tcr
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d6cwea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cwea1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d6cwea1:

Click to download the PDB-style file with coordinates for d6cwea1.
(The format of our PDB-style files is described here.)

Timeline for d6cwea1: