Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries) |
Domain d6cwec2: 6cwe C:116-204 [367050] Other proteins in same PDB: d6cwea1, d6cwea2, d6cweb_, d6cwec1, d6cwed1, d6cwed2 automated match to d2pyfa2 complexed with 7lp, fuc, nag, plm |
PDB Entry: 6cwe (more details), 2.2 Å
SCOPe Domain Sequences for d6cwec2:
Sequence, based on SEQRES records: (download)
>d6cwec2 b.1.1.2 (C:116-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
>d6cwec2 b.1.1.2 (C:116-204) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqdsdvyitdkcvldmrsmdfksnsav awsndfacanafnnsiipedtffps
Timeline for d6cwec2: