SCOPe 2.07: Domain d6cw6c2: 6cw6 C:116-204

Lineage for d6cw6c2 (6cw6 C:116-204)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6cw6c2: 6cw6 C:116-204 [367041]
   Other proteins in same PDB: d6cw6a1, d6cw6a2, d6cw6b_, d6cw6c1, d6cw6d1, d6cw6d2
   automated match to d2pyfa2
   complexed with fuc, nag, pbs, plm

Details for d6cw6c2

PDB Entry: 6cw6, 2.85 Å

PDB Description: structure of alpha-gc[8,18] bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (C:) Chimeric T cell antigen receptor alpha chain

SCOPe Domain Sequences for d6cw6c2:

Sequence, based on SEQRES records:

>d6cw6c2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d6cw6c2 b.1.1.2 (C:116-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

Timeline for d6cw6c2:

• d6cw6c2 is new in SCOPe 2.07-stable
  
• d6cw6c2 appears in the current release, SCOPe 2.08