SCOPe 2.07: Domain d6cw6c1: 6cw6 C:2-115

Lineage for d6cw6c1 (6cw6 C:2-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6cw6c1: 6cw6 C:2-115 [367040]
   Other proteins in same PDB: d6cw6a1, d6cw6b_, d6cw6c2
   automated match to d2pyfa1
   complexed with fuc, nag, pbs, plm

Details for d6cw6c1

PDB Entry: 6cw6, 2.85 Å

PDB Description: structure of alpha-gc[8,18] bound by cd1d and in complex with the va14vb8.2 tcr

PDB Compounds: (C:) Chimeric T cell antigen receptor alpha chain

SCOPe Domain Sequences for d6cw6c1:

Sequence; same for both SEQRES and ATOM records:

>d6cw6c1 b.1.1.0 (C:2-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d6cw6c1:

• d6cw6c1 is new in SCOPe 2.07-stable
  
• d6cw6c1 appears in the current release, SCOPe 2.08