SCOPe 2.07: Domain d6o4na2: 6o4n A:143-424

Lineage for d6o4na2 (6o4n A:143-424)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (78 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:471473] [366251] (1 PDB entry)

8. Domain d6o4na2: 6o4n A:143-424 [366252]
   Other proteins in same PDB: d6o4na1, d6o4nb1
   automated match to d4ywsa2
   complexed with cl, edo, mg, mrd, po4

Details for d6o4na2

PDB Entry: 6o4n, 1.8 Å

PDB Description: crystal structure of enolase from chlamydia trachomatis

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d6o4na2:

Sequence; same for both SEQRES and ATOM records:

>d6o4na2 c.1.11.0 (A:143-424) automated matches {Chlamydia trachomatis [TaxId: 471473]}
vlpcpmmnlinggmhatnglqfqefmirpisapslkeavrmgaevfnalkkilqnrqlat
gvgdeggfapnlasnaealdllltaietagftpredislaldcaassfyntqdktydgks
yadqvgilaelcehypidsiedglaeedfegwkllsetlgdrvqlvgddlfvtnsaliae
giaqglanavlikpnqigtltetaeairlatiqgyatilshrsgetedttiadlavafnt
gqiktgslsrseriakynrlmaieeemgpealfqdsnpfska

Timeline for d6o4na2:

• d6o4na2 is new in SCOPe 2.07-stable
  
• d6o4na2 appears in the current release, SCOPe 2.08