SCOPe 2.07: Domain d6o4na1: 6o4n A:3-142

Lineage for d6o4na1 (6o4n A:3-142)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (94 species)
   not a true protein

7. Species Chlamydia trachomatis [TaxId:471473] [366249] (1 PDB entry)

8. Domain d6o4na1: 6o4n A:3-142 [366250]
   Other proteins in same PDB: d6o4na2, d6o4nb2
   automated match to d4ywsa1
   complexed with cl, edo, mg, mrd, po4

Details for d6o4na1

PDB Entry: 6o4n, 1.8 Å

PDB Description: crystal structure of enolase from chlamydia trachomatis

PDB Compounds: (A:) enolase

SCOPe Domain Sequences for d6o4na1:

Sequence; same for both SEQRES and ATOM records:

>d6o4na1 d.54.1.0 (A:3-142) automated matches {Chlamydia trachomatis [TaxId: 471473]}
dvvisdieareildsrgyptlcvkvitntgtfgeacvpsgastgikealelrdkdpkryq
gkgvlqaisnvekvlvpalqgfsvfdqitadaimidadgtpnkeklganailgvslalak
aaantlqrplyrylggsfsh

Timeline for d6o4na1:

• d6o4na1 is new in SCOPe 2.07-stable
  
• d6o4na1 appears in the current release, SCOPe 2.08