Lineage for d1bb7__ (1bb7 -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 76064Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 76065Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 76074Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 76107Protein Lysozyme [53961] (14 species)
  7. 76479Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)
  8. 76485Domain d1bb7__: 1bb7 - [36593]

Details for d1bb7__

PDB Entry: 1bb7 (more details), 2 Å

PDB Description: lysozyme complex with 4-methyl-umbelliferyl chitobiose

SCOP Domain Sequences for d1bb7__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bb7__ d.2.1.2 (-) Lysozyme {Rainbow trout (Oncorhynchus mykiss)}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

SCOP Domain Coordinates for d1bb7__:

Click to download the PDB-style file with coordinates for d1bb7__.
(The format of our PDB-style files is described here.)

Timeline for d1bb7__: