SCOPe 2.05: Domain d1lmca_: 1lmc A:

Lineage for d1lmca_ (1lmc A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein Lysozyme [53961] (14 species)
   ubiquitous in a variety of tissues and secretions

7. Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [53973] (7 PDB entries)

8. Domain d1lmca_: 1lmc A: [36592]
   complexed with bul

Details for d1lmca_

PDB Entry: 1lmc, 2 Å

PDB Description: the crystal structure of a complex between bulgecin, a bacterial metabolite, and lysozyme from the rainbow trout

PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1lmca_:

Sequence; same for both SEQRES and ATOM records:

>d1lmca_ d.2.1.2 (A:) Lysozyme {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
kvydrcelaralkasgmdgyagnslpnwvclskwessyntqatnrntdgstdygifqins
rywcddgrtpgaknvcgircsqlltddltvaircakrvvldpngigawvawrlhcqnqdl
rsyvagcgv

Timeline for d1lmca_:

• d1lmca_ first appeared (with stable ids) in SCOP 1.55, called d1lmc__
  
• d1lmca_ appears in SCOPe 2.04
  
• d1lmca_ appears in SCOPe 2.06
  
• d1lmca_ appears in the current release, SCOPe 2.08