SCOPe 2.07: Domain d6qa2b_: 6qa2 B:

Lineage for d6qa2b_ (6qa2 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.0: automated matches [191597] (1 protein)
   not a true family

6. Protein automated matches [191087] (19 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:419947] [365457] (1 PDB entry)

8. Domain d6qa2b_: 6qa2 B: [365582]
   automated match to d4anea_
   complexed with so4, tam; mutant

Details for d6qa2b_

PDB Entry: 6qa2, 2.2 Å

PDB Description: r80a mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d6qa2b_:

Sequence, based on SEQRES records:

>d6qa2b_ d.58.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
llefitsgpvvaaivegtaaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
aesaqreialwfpga

Sequence, based on observed residues (ATOM records):

>d6qa2b_ d.58.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelpffgsllefitsgpvv
aaivegtaaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsdsaesaqreialw
fpga

Timeline for d6qa2b_:

• d6qa2b_ is new in SCOPe 2.07-stable
  
• d6qa2b_ appears in the current release, SCOPe 2.08