Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.0: automated matches [191597] (1 protein) not a true family |
Protein automated matches [191087] (19 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:419947] [365457] (1 PDB entry) |
Domain d6qa2e_: 6qa2 E: [365472] automated match to d4anea_ complexed with so4, tam; mutant |
PDB Entry: 6qa2 (more details), 2.2 Å
SCOPe Domain Sequences for d6qa2e_:
Sequence, based on SEQRES records: (download)
>d6qa2e_ d.58.6.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs llefitsgpvvaaivegtaaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds aesaqreialwfpga
>d6qa2e_ d.58.6.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaeheglefits gpvvaaivegtaaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsdsaesaqre ialwfpga
Timeline for d6qa2e_: