Lineage for d6qa2e_ (6qa2 E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2557935Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2558476Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2558477Protein automated matches [191087] (19 species)
    not a true protein
  7. 2558675Species Mycobacterium tuberculosis [TaxId:419947] [365457] (1 PDB entry)
  8. 2558680Domain d6qa2e_: 6qa2 E: [365472]
    automated match to d4anea_
    complexed with so4, tam; mutant

Details for d6qa2e_

PDB Entry: 6qa2 (more details), 2.2 Å

PDB Description: r80a mutant of nucleoside diphosphate kinase from mycobacterium tuberculosis
PDB Compounds: (E:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d6qa2e_:

Sequence, based on SEQRES records: (download)

>d6qa2e_ d.58.6.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
llefitsgpvvaaivegtaaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
aesaqreialwfpga

Sequence, based on observed residues (ATOM records): (download)

>d6qa2e_ d.58.6.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaeheglefits
gpvvaaivegtaaiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsdsaesaqre
ialwfpga

SCOPe Domain Coordinates for d6qa2e_:

Click to download the PDB-style file with coordinates for d6qa2e_.
(The format of our PDB-style files is described here.)

Timeline for d6qa2e_: