Lineage for d6qjed1 (6qje D:6-216)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537678Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins)
  6. 2537745Protein automated matches [232306] (2 species)
    not a true protein
  7. 2537746Species Homo sapiens [TaxId:9606] [362871] (13 PDB entries)
  8. 2537788Domain d6qjed1: 6qje D:6-216 [365563]
    Other proteins in same PDB: d6qjea2, d6qjeb2, d6qjeb3, d6qjec2, d6qjed2
    automated match to d1wuua1
    complexed with gal, hfk, j4q, so4

Details for d6qjed1

PDB Entry: 6qje (more details), 2.4 Å

PDB Description: structure of human galactokinase 1 bound with 4-{[2-(methylsulfonyl)- 1h-imidazol-1-yl]methyl}-1,3-thiazole
PDB Compounds: (D:) Galactokinase

SCOPe Domain Sequences for d6qjed1:

Sequence, based on SEQRES records: (download)

>d6qjed1 d.14.1.5 (D:6-216) automated matches {Homo sapiens [TaxId: 9606]}
qpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtvlvg
sprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplpgf
savvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcgim
dqfislmgqkghallidcrsletslvplsdp

Sequence, based on observed residues (ATOM records): (download)

>d6qjed1 d.14.1.5 (D:6-216) automated matches {Homo sapiens [TaxId: 9606]}
qpqvaellaeafreefgepelavsapgrvnligehtdynqglvlpmalelmtvlvgspdg
lvsllttrlqfplppgtprwanyvkgviqyypaaplpgfsavvvssvplggglsssasle
vatytflqqlcpdsqvcqqaehsfmdqfislmgqkghallidcrsletslvplsdp

SCOPe Domain Coordinates for d6qjed1:

Click to download the PDB-style file with coordinates for d6qjed1.
(The format of our PDB-style files is described here.)

Timeline for d6qjed1: