Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily) core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover |
Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) |
Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 proteins) |
Protein automated matches [232306] (2 species) not a true protein |
Species Homo sapiens [TaxId:9606] [362871] (13 PDB entries) |
Domain d6qjec1: 6qje C:3-216 [365521] Other proteins in same PDB: d6qjea2, d6qjeb2, d6qjeb3, d6qjec2, d6qjed2 automated match to d1wuua1 complexed with gal, hfk, j4q, so4 |
PDB Entry: 6qje (more details), 2.4 Å
SCOPe Domain Sequences for d6qjec1:
Sequence, based on SEQRES records: (download)
>d6qjec1 d.14.1.5 (C:3-216) automated matches {Homo sapiens [TaxId: 9606]} alrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtv lvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaapl pgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpc gimdqfislmgqkghallidcrsletslvplsdp
>d6qjec1 d.14.1.5 (C:3-216) automated matches {Homo sapiens [TaxId: 9606]} alrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmtv lvgsprlvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaaplpgf savvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmpcgim dqfislmgqkghallidcrsletslvplsdp
Timeline for d6qjec1: