SCOPe 2.07: Domain d6nm6v_: 6nm6 V:

Lineage for d6nm6v_ (6nm6 V:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (320 PDB entries)

8. Domain d6nm6v_: 6nm6 V: [365527]
   Other proteins in same PDB: d6nm6d_, d6nm6e_, d6nm6l1, d6nm6l2, d6nm6u_
   automated match to d4n1ca_
   complexed with bma, man, nag

Details for d6nm6v_

PDB Entry: 6nm6, 2.74 Å

PDB Description: crystal structure of hiv-1 bg505 sosip.664 prefusion env trimer bound to n6 fr3-03 scfv in complex with crystallization chaperones 3h109l fab and 35o22 scfv at 3.2 angstrom

PDB Compounds: (V:) N6 FR3-03 light chain

SCOPe Domain Sequences for d6nm6v_:

Sequence; same for both SEQRES and ATOM records:

>d6nm6v_ b.1.1.1 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hvtqspsslsvsigdrvtincqtsqgvgsdlhwyqhkpgrapkllihhtssvedgvpsrf
sgsgfhtsfnltisdlqaddiatyycqvlqffgrgsrlh

Timeline for d6nm6v_:

• d6nm6v_ is new in SCOPe 2.07-stable
  
• d6nm6v_ appears in the current release, SCOPe 2.08