Lineage for d6nm6v_ (6nm6 V:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (228 PDB entries)
  8. 3065465Domain d6nm6v_: 6nm6 V: [365527]
    Other proteins in same PDB: d6nm6d_, d6nm6e_, d6nm6l1, d6nm6l2, d6nm6u_
    automated match to d4n1ca_
    complexed with bma, man, nag

Details for d6nm6v_

PDB Entry: 6nm6 (more details), 2.74 Å

PDB Description: crystal structure of hiv-1 bg505 sosip.664 prefusion env trimer bound to n6 fr3-03 scfv in complex with crystallization chaperones 3h109l fab and 35o22 scfv at 3.2 angstrom
PDB Compounds: (V:) N6 FR3-03 light chain

SCOPe Domain Sequences for d6nm6v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nm6v_ b.1.1.1 (V:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hvtqspsslsvsigdrvtincqtsqgvgsdlhwyqhkpgrapkllihhtssvedgvpsrf
sgsgfhtsfnltisdlqaddiatyycqvlqffgrgsrlh

SCOPe Domain Coordinates for d6nm6v_:

Click to download the PDB-style file with coordinates for d6nm6v_.
(The format of our PDB-style files is described here.)

Timeline for d6nm6v_: