SCOPe 2.07: Domain d5znlb_: 5znl B:

Lineage for d5znlb_ (5znl B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (136 PDB entries)

8. Domain d5znlb_: 5znl B: [365222]
   automated match to d4ajmd_
   complexed with 9g6, mg, zn

Details for d5znlb_

PDB Entry: 5znl, 2.8 Å

PDB Description: crystal structure of pde10a catalytic domain complexed with lhb-6

PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5znlb_:

Sequence; same for both SEQRES and ATOM records:

>d5znlb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyr
rvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdh
plaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfg
nrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaeg
demkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnls
qwekvirge

Timeline for d5znlb_:

• d5znlb_ is new in SCOPe 2.07-stable
  
• d5znlb_ appears in the current release, SCOPe 2.08