Lineage for d5znlb_ (5znl B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2342123Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 2342124Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 2342564Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 2342565Protein automated matches [190983] (9 species)
    not a true protein
  7. 2342579Species Human (Homo sapiens) [TaxId:9606] [188676] (127 PDB entries)
  8. 3065160Domain d5znlb_: 5znl B: [365222]
    automated match to d4ajmd_
    complexed with 9g6, mg, zn

Details for d5znlb_

PDB Entry: 5znl (more details), 2.8 Å

PDB Description: crystal structure of pde10a catalytic domain complexed with lhb-6
PDB Compounds: (B:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5znlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5znlb_ a.211.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvkknyr
rvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylqkfdh
plaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdlalyfg
nrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaefwaeg
demkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacrdnls
qwekvirge

SCOPe Domain Coordinates for d5znlb_:

Click to download the PDB-style file with coordinates for d5znlb_.
(The format of our PDB-style files is described here.)

Timeline for d5znlb_:

  • d5znlb_ appears in periodic updates to SCOPe 2.07 starting on 2019-02-21