SCOPe 2.07: Domain d6jc0d_: 6jc0 D:

Lineage for d6jc0d_ (6jc0 D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families)

5. Family d.41.5.0: automated matches [191646] (1 protein)
   not a true family

6. Protein automated matches [191185] (6 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [364854] (1 PDB entry)

8. Domain d6jc0d_: 6jc0 D: [364988]
   automated match to d2wp4a_

Details for d6jc0d_

PDB Entry: 6jc0, 2.1 Å

PDB Description: structural analysis of molybdopterin synthases from two mycobacteria pathogens

PDB Compounds: (D:) Putative molybdenum cofactor biosynthesis protein

SCOPe Domain Sequences for d6jc0d_:

Sequence; same for both SEQRES and ATOM records:

>d6jc0d_ d.41.5.0 (D:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
msaeivrveltedpislteyealvaheaagavvgfagvvrdhdggrsvlrleysahptaq
rtleevaeeiaaqsdgvraiavshrigplkigdaalvaavaadhrraafetcarlvdvvk
erlpvwkhqhfadgtdewvns

Timeline for d6jc0d_:

• d6jc0d_ is new in SCOPe 2.07-stable
  
• d6jc0d_ appears in the current release, SCOPe 2.08